PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34907.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 609aa    MW: 68251.9 Da    PI: 5.1388
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34907.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.72.1e-12172220250
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  + kr  r+++NRe+A+ sRqRKk ++eeLeekvk++e   ++L ++++
  KFK34907.1 172 DDEKRNVRLIRNRESAQLSRQRKKHYVEELEEKVKKMEFMIMDLNSKVS 220
                 5679*********************************999999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.9E-14171235IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.921173233IPR004827Basic-leucine zipper domain
PfamPF001701.6E-10174232IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.75E-11175233No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-15175233No hitNo description
CDDcd147044.15E-18176226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MADSVTEKTL IHDTNSIPYS LFDDDNFYNS ISDHALFRNS ISDLRLFIDG DEEFELNLDI  60
VDDLYFPSEN ESFVVPIDTT NRSEISSDFV LSTSGCCNRD SDCSDTTQIS ENFVFDVSEA  120
TIASSSPESE EMVVDYQKLK VEEEEITKKR RKEEDTSRNV KYRRLNYEEE EDDEKRNVRL  180
IRNRESAQLS RQRKKHYVEE LEEKVKKMEF MIMDLNSKVS YFVAENVALR QQLGLGSGMC  240
RSPLVPVAYQ WLHCPGSQVP LLPIPRLKPP PQQSVANKVK RKMKKVASVS VLGFLFCLFL  300
FGALAPIVNV RYSDRVYDHS RGRVLDVFVD SNRESCGRDF DQGVGRNVSV VENFEVMGNG  360
SEHLVASLFV PRNDKLVKID GNLIIHSVLA SEKAKVSETK NNEGESSVAT SEAVLPLPEF  420
TRTRDLSKHL YSEKRKALLS SGSDDTLKDQ LESTTANGDM QQWFREGVAG PMFSSGMCTE  480
VFQFDVSSTS GAIIPASPAT KQPKNATDTH KGKKNRRILR GGLPVSDFSL TKDQNSSSKE  540
NFQETKPGPS MVVSVLVDPR EGGDGDIDGM IGRTKSLSRV FIVLLVDGVK YVTYSCVLPQ  600
PQVPHIVTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147151KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402962.10.0hypothetical protein EUTSA_v10005827mg
SwissprotQ9LXX40.0BZP49_ARATH; bZIP transcription factor 49
TrEMBLA0A087GYF50.0A0A087GYF5_ARAAL; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50017220.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16991911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.11e-179basic region/leucine zipper motif protein 49